greentea387 OP t1_iw2g7mz wrote
ESMFold by Meta and AlphaFold by Google's DeepMind
Model Confidence:
dark blue: Very high (pLDDT > 90)
light blue: Confident (90 > pLDDT > 70)
yellow: Low (70 > pLDDT > 50)
orange: Very low (pLDDT < 50)
Protein: Serotonin receptor 2beta
Organism: Gryllus bimaculatus
Protein Sequence: EQKATKVLGVVFFTFVVLWAPFFVLNLVPTVCGEECERRIDHRVFDFVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLTCQYRKKVWRPPA
draem t1_iw2gfxn wrote
is there any experimental data to compare?
phriot t1_iw2gytu wrote
It's probably a membrane protein, which would make it difficult to crystalize to get a structure experimentally. That's the promise of software like AlphaFold.
MyCoffeeTableIsShit t1_iw4iwiq wrote
I would like to introduce you to the world of mesophase crystallisation, good sir.
iyke7991 t1_iw6g0cs wrote
Advantages?
MyCoffeeTableIsShit t1_iw6pu0e wrote
It provides an artificial lipid matrix which stabilises multiple domains simultaneously making some membrane proteins more amenable to crystallisation.
iyke7991 t1_iw8j66b wrote
Ahhh, will need to look into it more. Some cutting edge stuff right there. Biology is way too complex. Endless forever evolving complexity. Absolutely beautiful. Make it stop. πππ
greentea387 OP t1_iw2gmao wrote
I don't think so for this protein
-ZeroRelevance- t1_iw32yzs wrote
Can you post another one which has been experimentally tested to see which oneβs more accurate?
greentea387 OP t1_iw6bup7 wrote
Sorry, I am not aware of such a protein
Viewing a single comment thread. View all comments