greentea387

greentea387 t1_j3he808 wrote

Hey, I also suffered brain damage. I agree with what the others answered, but I would like to add that it is very helpful to really get deep into the topic and figure out the exact mechanism that is causing your problem. Like, what are the neural mechanisms underlying brain damage-induced functional deficits? What exact molecular challenges need to be overcome in order to restore function? Why is it currently not possible?

I find that addressing questions like these in as much detail as possible can provide much better insight into the nature of the problem and help you assess the impact of upcoming research. Like when you read something in the news saying "brain damage is now curable (study x has found y)" then you are in a much better position to discern what that actually means for your condition.

I recommend the book "Principles of Neural Science". It's expensive but there are always ways to get the PDF for free :)

1

greentea387 OP t1_iw2g7mz wrote

ESMFold by Meta and AlphaFold by Google's DeepMind

Model Confidence:

dark blue: Very high (pLDDT > 90)

light blue: Confident (90 > pLDDT > 70)

yellow: Low (70 > pLDDT > 50)

orange: Very low (pLDDT < 50)

Protein: Serotonin receptor 2beta

Organism: Gryllus bimaculatus

Protein Sequence: EQKATKVLGVVFFTFVVLWAPFFVLNLVPTVCGEECERRIDHRVFDFVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLTCQYRKKVWRPPA

33